Proteintech, 60631-7-Ig, TMED9 Monoclonal antibody

Size: 20ul / 150ul The TMED9 (60631-7-Ig) by Proteintech is a Monoclonal antibody targeting TMED9 in WB, ELISA applications with reactivity to human, mouse, rat samples 60631-7-Ig targets TMED9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HepG2 cells, K-562 cells, pig liver tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TMED9 (also named as GMP25, GP25L2, or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13754 Product name: Recombinant human TMED9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC001123 Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH Predict reactive species Full Name: transmembrane emp24 protein transport domain containing 9 Calculated Molecular Weight: 235 aa, 27 kDa Observed Molecular Weight: 24-27 kDa GenBank Accession Number: BC001123 Gene Symbol: TMED9 Gene ID (NCBI): 54732 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BVK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.