Proteintech, 60640-3-Ig, OSBPL3 Monoclonal antibody

Size: 20ul / 150ul The OSBPL3 (60640-3-Ig) by Proteintech is a Monoclonal antibody targeting OSBPL3 in WB, ELISA applications with reactivity to human samples 60640-3-Ig targets OSBPL3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, HeLa cells, SCaBER cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The oxysterol-binding protein-like (OSBPL) protein family includes nine members namely OSBPL2, OSBPL3, OSBPL5, OSBPL6, OSBPL7, OSBPL8, OSBPL9, OSBPL10, and OSBPL11. The OSBPL family proteins (OSBPLs) are located at the membrane to exchange molecules or signals between organelles and function as a necessary transporter. In addition to lipid transport, the OSBPLs are involved in the regulation of the actin cytoskeleton, cell polarity, and cell. Recently, the role of OSBPLs in cancer development has been gradually revealed. Upregulation of OSBPL3 could promote colorectal cancer. (PMID: 36918840) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26294 Product name: Recombinant human OSBPL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC017731 Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA Predict reactive species Full Name: oxysterol binding protein-like 3 Calculated Molecular Weight: 887 aa, 101 kDa Observed Molecular Weight: 95-110 kDa GenBank Accession Number: BC017731 Gene Symbol: OSBPL3 Gene ID (NCBI): 26031 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H4L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.