Proteintech, 60717-8-Ig, IGFBP1 Monoclonal antibody

Size: 20ul / 150ul The IGFBP1 (60717-8-Ig) by Proteintech is a Monoclonal antibody targeting IGFBP1 in WB, ELISA applications with reactivity to human, rabbit samples 60717-8-Ig targets IGFBP1 in WB, ELISA applications and shows reactivity with human, rabbit samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta tissue, human plasma, rabbit liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information IGF-binding proteins (IGFBPs) family contains members like IGFBP-1, -2, -3, -4,-5 and-6. IGFBPs prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGF-I physically interacts with IGFBP-1 and that IGFBP-1 also binds to an integrin receptor, but the effect of IGFBP-1 on cell migration may be independent of IGF-I and is probably mediated through the alpha 5 beta 1 integrin. Transgenic mice models demonstrated that IGFBPs played important roles in the pathogenesis of obesity and INS resistance. Studies conducted in humans demonstrated the close relation between IGFBPs and the components of the metabolic syndrome. Specification Tested Reactivity: human, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Eg0951 Product name: Recombinant Human IGFBP-1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-259 aa of NM_000596.4 Sequence: APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Predict reactive species Full Name: IGF binding protein 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-35 kDa GenBank Accession Number: NM_000596.4 Gene Symbol: IGFBP1 Gene ID (NCBI): 3484 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08833 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.