Proteintech, 60905-1-Ig, USP22 Monoclonal antibody

Size: 20ul / 150ul The USP22 (60905-1-Ig) by Proteintech is a Monoclonal antibody targeting USP22 in WB, ELISA applications with reactivity to human samples 60905-1-Ig targets USP22 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information USP22, also named as KIAA1063 and USP3L, belongs to the peptidase C19 family and UBP8 subfamily. It is histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. USP22 catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. It is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. USP22 is required for nuclear receptor-mediated transactivation and cell cycle progression. USP22 has 2 isoforms with molecular mass of 58kDa and 60 kDa. The antibody is specific to USP22. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34933 Product name: Recombinant human USP22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 130-176 aa of NM_015276 Sequence: MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR Predict reactive species Full Name: ubiquitin specific peptidase 22 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_015276 Gene Symbol: USP22 Gene ID (NCBI): 23326 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UPT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.