Iright
BRAND / VENDOR: Proteintech

Proteintech, 60908-3-Ig, EPHB2 Monoclonal antibody

CATALOG NUMBER: 60908-3-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EPHB2 (60908-3-Ig) by Proteintech is a Monoclonal antibody targeting EPHB2 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 60908-3-Ig targets EPHB2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: Saos-2 cells, HeLa cells, U2OS cells, rat brain tissue, mouse brain tissue, rabbit brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information EPHB2 is a receptor tyrosine kinase that mediates ephrin-dependent bidirectional signaling to control cell positioning, boundary formation, and tissue architecture. Expressed in the nervous system and intestinal epithelium, EPHB2 regulates axon guidance, synaptic plasticity, and epithelial organization. Loss or dysregulation of EPHB2 contributes to colorectal cancer progression and altered neural connectivity, underscoring its central role in developmental patterning and tissue homeostasis. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28796 Product name: Recombinant human EPHB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species Full Name: EPH receptor B2 Calculated Molecular Weight: 987 aa, 108 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC018763 Gene Symbol: EPHB2 Gene ID (NCBI): 2048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29323 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924