Proteintech, 60919-1-Ig, Pericentrin Monoclonal antibody

Size: 20ul / 150ul The Pericentrin (60919-1-Ig) by Proteintech is a Monoclonal antibody targeting Pericentrin in IF/ICC, ELISA applications with reactivity to human samples 60919-1-Ig targets Pericentrin in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Pericentrin (PCNT) is a large, highly conserved centrosomal protein essential for organizing the pericentriolar material (PCM)-the matrix surrounding the centrioles that nucleates and anchors microtubules. It acts as a scaffold that recruits and positions key regulatory complexes, including γ-tubulin ring complexes (γ-TuRCs), protein kinase A (PKA) and dynein, thereby orchestrating microtubule nucleation, spindle assembly and centrosome maturation throughout the cell cycle Specification Tested Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27248 Product name: Recombinant human PCNT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-200 aa of AK093923 Sequence: MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI Predict reactive species Full Name: pericentrin Calculated Molecular Weight: 378 kDa GenBank Accession Number: AK093923 Gene Symbol: Pericentrin Gene ID (NCBI): 5116 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: O95613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.