Iright
BRAND / VENDOR: Proteintech

Proteintech, 61032-3-Ig, FMO1 Monoclonal antibody

CATALOG NUMBER: 61032-3-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FMO1 (61032-3-Ig) by Proteintech is a Monoclonal antibody targeting FMO1 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 61032-3-Ig targets FMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig liver tissue, pig kidney tissue, rabbit kidney tissue, Rabbit liver tissue, Rat liver tissue, Mouse liver tissue, Rat kidney tissue, Mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 kDa and 60 kDa. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34286 Product name: Recombinant human FMO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-430 aa of NM_001282692 Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS Predict reactive species Full Name: flavin containing monooxygenase 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 50-53 kDa GenBank Accession Number: NM_001282692 Gene Symbol: FMO1 Gene ID (NCBI): 2326 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q01740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924