Iright
BRAND / VENDOR: Proteintech

Proteintech, 66013-1-Ig, HLA class I ABC Monoclonal antibody

CATALOG NUMBER: 66013-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HLA class I ABC (66013-1-Ig) by Proteintech is a Monoclonal antibody targeting HLA class I ABC in WB, IHC, IF/ICC, FC, IP, ELISA applications with reactivity to human, pig samples 66013-1-Ig targets HLA class I ABC in WB, IHC, IF/ICC, IF-P, FC, IP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, human white blood, NCCIT cells, pig spleen tissue, U-937 cells, Raji cells, HEK-293 cells, Jurkat cells Positive IP detected in: HepG2 cells Positive IHC detected in: human tonsillitis tissue, human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Raji cells Positive FC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250) Specification Tested Reactivity: human, pig Cited Reactivity: human, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7488 Product name: Recombinant human HLA class I (HLA-A) protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-302 aa of BC003069 Sequence: MRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS Predict reactive species Full Name: major histocompatibility complex, class I, A Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 40-44 kDa GenBank Accession Number: BC003069 Gene Symbol: HLA-A Gene ID (NCBI): 3105 RRID: AB_11042593 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924