Iright
BRAND / VENDOR: Proteintech

Proteintech, 66049-1-Ig, MMS19 Monoclonal antibody

CATALOG NUMBER: 66049-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MMS19 (66049-1-Ig) by Proteintech is a Monoclonal antibody targeting MMS19 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 66049-1-Ig targets MMS19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, fetal human brain tissue, HEK-293 cells, HepG2 cells, human brain tissue, human kidney tissue, NIH/3T3 cells, rat brain tissue, RAW 264.7 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse testis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information MMS19 (MMS19 nucleotide excision repair homolog), also known as MET18, is a 1,030 amino acid nuclear protein containing seven HEAT repeats that belongs to the MET18/MMS19 family. Via its interactions with TFIIH p80 and TFIIH p89 helicases, MMS19 plays a role in nucleotide excision repair (NER) and RNA polymerase II (Pol II) transcription. MMS19 may also function as a transcriptional coactivator of estrogen receptor. While ubiquitously expressed, highest levels of MMS19 have been found in testis. At least five distinct MMS19 protein isoforms exist, which are produced by alternative splicing events. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8960 Product name: Recombinant human MMS19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 457-803 aa of BC006575 Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS Predict reactive species Full Name: MMS19 nucleotide excision repair homolog (S. cerevisiae) Calculated Molecular Weight: 1030 aa, 113 kDa Observed Molecular Weight: 103 kDa, 38 kDa GenBank Accession Number: BC006575 Gene Symbol: MMS19 Gene ID (NCBI): 64210 RRID: AB_11041708 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96T76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924