Proteintech, 66056-1-Ig, RACGAP1 Monoclonal antibody

Size: 20ul / 150ul The RACGAP1 (66056-1-Ig) by Proteintech is a Monoclonal antibody targeting RACGAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66056-1-Ig targets RACGAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HEK293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:1000 Background Information Rac GTPase-activating protein 1 (RACGAP1), localized in the mitotic spindle, has guanosine triphosphatase-activating protein (GAP) activity for the Rho family GTPases. RACGAP1 has an important influence on the initiation of cytokinesis, control of cell growth and differentiation, regulation of spermatogenesis, and tumor metastasis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6944 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 334-632 aa of BC032754 Sequence: PCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species Full Name: Rac GTPase activating protein 1 Calculated Molecular Weight: 632 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032754 Gene Symbol: RACGAP1 Gene ID (NCBI): 29127 RRID: AB_11043178 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H0H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.