Iright
BRAND / VENDOR: Proteintech

Proteintech, 66057-1-Ig, Cofilin Monoclonal antibody

CATALOG NUMBER: 66057-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cofilin (66057-1-Ig) by Proteintech is a Monoclonal antibody targeting Cofilin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66057-1-Ig targets Cofilin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, SH-SY5Y cells, A431 cells, PC-12 cells, Neuro-2a cells Positive IHC detected in: human testis tissue, human lung cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation. Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18044 Product name: Recombinant human Cofilin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species Full Name: cofilin 1 (non-muscle) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC012318 Gene Symbol: Cofilin Gene ID (NCBI): 1072 RRID: AB_11043339 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23528 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924