Proteintech, 66058-1-Ig, RAB27A Monoclonal antibody

Size: 20ul / 150ul The RAB27A (66058-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB27A in WB, IHC, ELISA applications with reactivity to human, mouse samples 66058-1-Ig targets RAB27A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K562, K-562 cells, Jurkat cells, HEK-293 cells, HL-60 cells, HepG2 cells Positive IHC detected in: human lymphoma tissue, human colon cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12382 Product name: Recombinant human RAB27A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-221 aa of BC107680 Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Predict reactive species Full Name: RAB27A, member RAS oncogene family Calculated Molecular Weight: 221 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC107680 Gene Symbol: RAB27A Gene ID (NCBI): 5873 RRID: AB_11042596 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P51159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.