Iright
BRAND / VENDOR: Proteintech

Proteintech, 66061-1-Ig, 14-3-3 Monoclonal antibody

CATALOG NUMBER: 66061-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The 14-3-3 (66061-1-Ig) by Proteintech is a Monoclonal antibody targeting 14-3-3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 66061-1-Ig targets 14-3-3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, human brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human lung cancer tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information 14-3-3 proteins interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6055 Product name: Recombinant human 14-3-3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-245 aa of BC056867 Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN Predict reactive species Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 31 kDa, 28 kDa GenBank Accession Number: BC056867 Gene Symbol: 14-3-3 theta Gene ID (NCBI): 10971 RRID: AB_11042772 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P27348 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924