Proteintech, 66063-1-Ig, NTF2 Monoclonal antibody

Size: 20ul / 150ul The NTF2 (66063-1-Ig) by Proteintech is a Monoclonal antibody targeting NTF2 in WB, IHC, ELISA applications with reactivity to human samples 66063-1-Ig targets NTF2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Hela cells, HepG2 cells, human heart tissue Positive IHC detected in: human placenta tissue, human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information NUTF2 (nuclear transport factor 2), also named as NTF2, is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and/or threonine kinase-dependent signal transduction mechanism(s) (PMID: 22880006). The MW of this protein is 14 kDa, and this antibody specially recognises the 14 kDa protein. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7879 Product name: Recombinant human NUTF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 10-127 aa of BC002348 Sequence: IGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG Predict reactive species Full Name: nuclear transport factor 2 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC002348 Gene Symbol: NTF2 Gene ID (NCBI): 10204 RRID: AB_11042770 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61970 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.