Proteintech, 66088-1-Ig, NCALD Monoclonal antibody

Size: 20ul / 150ul The NCALD (66088-1-Ig) by Proteintech is a Monoclonal antibody targeting NCALD in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, pig, rat samples 66088-1-Ig targets NCALD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, human brain tissue, pig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IHC detected in: human cerebellum tissue, mouse cerebellum tissue, human testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3200 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD. Specification Tested Reactivity: human, mouse, pig, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18760 Product name: Recombinant human NCALD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species Full Name: neurocalcin delta Calculated Molecular Weight: 193 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC036098 Gene Symbol: NCALD Gene ID (NCBI): 83988 RRID: AB_11232229 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61601 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.