Proteintech, 66089-1-Ig, Factor XII Monoclonal antibody

Size: 20ul / 150ul The Factor XII (66089-1-Ig) by Proteintech is a Monoclonal antibody targeting Factor XII in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 66089-1-Ig targets Factor XII in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K562 cells, K-562 cells Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Factor XII (F XII, Hageman factor) is a 80 kDa, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3401 Product name: Recombinant human F12 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 316-615 aa of BC012390 Sequence: MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS Predict reactive species Full Name: coagulation factor XII (Hageman factor) Calculated Molecular Weight: 615 aa, 68 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC012390 Gene Symbol: Factor XII Gene ID (NCBI): 2161 RRID: AB_11232031 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.