Proteintech, 66091-1-Ig, FKBP2 Monoclonal antibody

Size: 20ul / 150ul The FKBP2 (66091-1-Ig) by Proteintech is a Monoclonal antibody targeting FKBP2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, rat, pig samples 66091-1-Ig targets FKBP2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: Human cerebellum tissue, human brain tissue, pig liver tissue, rat brain tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant(PMID:8373365). Specification Tested Reactivity: human, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19113 Product name: Recombinant human FKBP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-142 aa of BC003384 Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL Predict reactive species Full Name: FK506 binding protein 2, 13kDa Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC003384 Gene Symbol: FKBP2 Gene ID (NCBI): 2286 RRID: AB_11232416 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P26885 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.