Iright
BRAND / VENDOR: Proteintech

Proteintech, 66097-1-Ig, ORM1/2 Monoclonal antibody

CATALOG NUMBER: 66097-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ORM1/2 (66097-1-Ig) by Proteintech is a Monoclonal antibody targeting ORM1/2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66097-1-Ig targets ORM1/2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, HuH-7 cells, human testis tissue Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein. This antibody recognizes both ORM1 and ORM2. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19248 Product name: Recombinant human ORM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-201 aa of BC026238 Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Predict reactive species Full Name: orosomucoid 1 Calculated Molecular Weight: 201 aa, 24 kDa Observed Molecular Weight: 40-47 kDa GenBank Accession Number: BC026238 Gene Symbol: ORM1 Gene ID (NCBI): 5004 RRID: AB_2881496 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924