Iright
BRAND / VENDOR: Proteintech

Proteintech, 66098-1-Ig, S100A6 Monoclonal antibody

CATALOG NUMBER: 66098-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The S100A6 (66098-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66098-1-Ig targets S100A6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. Although S100A6 is a cytoplasmic protein, it can be located in the nuclear and cytoplasmic membranes in the presence of Ca2+ (PMID: 37670392). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17606 Product name: Recombinant human S100A6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC001431 Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG Predict reactive species Full Name: S100 calcium binding protein A6 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC001431 Gene Symbol: S100A6 Gene ID (NCBI): 6277 RRID: AB_2881497 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P06703 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924