Proteintech, 66100-1-Ig, PDCD4 Monoclonal antibody

Size: 20ul / 150ul The PDCD4 (66100-1-Ig) by Proteintech is a Monoclonal antibody targeting PDCD4 in WB, IHC, ELISA applications with reactivity to human samples 66100-1-Ig targets PDCD4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Programmed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19239 Product name: Recombinant human PDCD4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 169-469 aa of BC026104 Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY Predict reactive species Full Name: programmed cell death 4 (neoplastic transformation inhibitor) Calculated Molecular Weight: 469 aa, 52 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC026104 Gene Symbol: PDCD4 Gene ID (NCBI): 27250 RRID: AB_2881499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q53EL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.