Iright
BRAND / VENDOR: Proteintech

Proteintech, 66118-1-Ig, FUT8 Monoclonal antibody

CATALOG NUMBER: 66118-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FUT8 (66118-1-Ig) by Proteintech is a Monoclonal antibody targeting FUT8 in WB, IHC, ELISA applications with reactivity to human, mouse samples 66118-1-Ig targets FUT8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, MDA-MB-453s cells, MCF-7 cells, Caco-2 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human lung cancer tissue, mouse cerebellum tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Fucosyltransferase 8 (FUT8) is GDP-fucose-glycoprotein fucosyltransferase and is localized in Golgi apparatus. FUT8 is involved in protein glycosylation by catalyzing the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans. FUT8 may be involved in human aging by regulating protein N-glycosylation and in the molecular pathogenesis of human pulmonary emphysema (PE). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18769 Product name: Recombinant human FUT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 276-575 aa of BC025385 Sequence: HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK Predict reactive species Full Name: fucosyltransferase 8 (alpha (1,6) fucosyltransferase) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC025385 Gene Symbol: FUT8 Gene ID (NCBI): 2530 RRID: AB_2881517 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BYC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924