Proteintech, 66130-1-Ig, RPL3 Monoclonal antibody

Size: 20ul / 150ul The RPL3 (66130-1-Ig) by Proteintech is a Monoclonal antibody targeting RPL3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66130-1-Ig targets RPL3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, HEK-293 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human lung cancer tissue, human placenta tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20400 Product name: Recombinant human RPL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 153-403 aa of BC012786 Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA Predict reactive species Full Name: ribosomal protein L3 Calculated Molecular Weight: 46/27 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC012786 Gene Symbol: RPL3 Gene ID (NCBI): 6122 RRID: AB_2881529 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P39023 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.