Iright
BRAND / VENDOR: Proteintech

Proteintech, 66133-1-Ig, Pancreatic alpha-amylase Monoclonal antibody

CATALOG NUMBER: 66133-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Pancreatic alpha-amylase (66133-1-Ig) by Proteintech is a Monoclonal antibody targeting Pancreatic alpha-amylase in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat, pig samples 66133-1-Ig targets Pancreatic alpha-amylase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: human saliva, tissue, pig pancreas tissue, rat pancreas tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:600-1:2400 Background Information The complete human amylase gene contains five intact genes: two pancreatic genes (AMY2A and AMY2B) and three salivary genes (AMYIA, AMYIB, and AMYIC). AMY2A(Pancreatic alpha-amylase)is also named as PA and is a 56 kDa protein consisting of 496 amino acids in a single polypeptide chain, folded into three domains(PMID:10657258). It has a hydrolase activity acting on glycosyl bonds. AMY2A and AMY2B transcripts are present in the human pancreas but not in the parotid salivary gland, while AMY1 transcripts are present in the parotid gland but not in the pancreas(PMID:1692956).This antibody can recognize amylase alpha. Specification Tested Reactivity: human, rat, pig Cited Reactivity: human, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8819 Product name: Recombinant human AMY2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-511 aa of BC007060 Sequence: DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species Full Name: amylase, alpha 2A (pancreatic) Calculated Molecular Weight: 511 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC007060 Gene Symbol: Amylase Alpha Gene ID (NCBI): 279 RRID: AB_2881532 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924