Iright
BRAND / VENDOR: Proteintech

Proteintech, 66144-1-Ig, IL-9 Monoclonal antibody

CATALOG NUMBER: 66144-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-9 (66144-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-9 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66144-1-Ig targets IL-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein, Recombinant protein protein Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21435 Product name: Recombinant human IL-9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 31-144 aa of BC066284 Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Predict reactive species Full Name: interleukin 9 Calculated Molecular Weight: 144 aa, 16 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC066284 Gene Symbol: IL9 Gene ID (NCBI): 3578 RRID: AB_2881541 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15248 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924