Proteintech, 66146-1-Ig, IL-6 Monoclonal antibody

Size: 20ul / 150ul The IL-6 (66146-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-6 in WB, IF/ICC, ELISA applications with reactivity to human samples 66146-1-Ig targets IL-6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells, Recombinant protein, Jurkat cells, HUVEC cells Positive IF/ICC detected in: LPS and Brefeldin A treated HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity. Specification Tested Reactivity: human Cited Reactivity: human, pig, zebrafish, sheep Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10646 Product name: Recombinant human IL-6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species Full Name: interleukin 6 (interferon, beta 2) Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC015511 Gene Symbol: IL6 Gene ID (NCBI): 3569 ENSEMBL Gene ID: ENSG00000136244 RRID: AB_2881543 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05231 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.