Proteintech, 66148-1-Ig, IL-17A Monoclonal antibody

Size: 20ul / 150ul The IL-17A (66148-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-17A in WB, IF-P, ELISA applications with reactivity to human, mouse samples 66148-1-Ig targets IL-17A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, Raji cells, U-937 cells, MOLT-4 cells, Ramos cells, Daudi cells, HL-60 cells, RAW 264.7 cells Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species Full Name: interleukin 17A Calculated Molecular Weight: 155 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC067505 Gene Symbol: IL-17A Gene ID (NCBI): 3605 ENSEMBL Gene ID: ENSG00000112115 RRID: AB_2881544 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16552 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.