Iright
BRAND / VENDOR: Proteintech

Proteintech, 66157-1-Ig, C3/C3b/C3c Monoclonal antibody

CATALOG NUMBER: 66157-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C3/C3b/C3c (66157-1-Ig) by Proteintech is a Monoclonal antibody targeting C3/C3b/C3c in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66157-1-Ig targets C3/C3b/C3c in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, human blood, human plasma, HepG2 cells, J774A.1 cells, RAW 264.7 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3, composed of α and β chains (115 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is further cleaved into iC3b, C3c, C3dg and C3f. This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 alpha chain, C3b alpha' chain, and C3c alpha' chain fragment 2. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15955 Product name: Recombinant human C3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1314-1663 aa of BC150179 Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN Predict reactive species Full Name: complement component 3 Calculated Molecular Weight: 1663 aa, 187 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC150179 Gene Symbol: C3 Gene ID (NCBI): 718 RRID: AB_2881553 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01024 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924