Iright
BRAND / VENDOR: Proteintech

Proteintech, 66172-1-Ig, MSH6 Monoclonal antibody

CATALOG NUMBER: 66172-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MSH6 (66172-1-Ig) by Proteintech is a Monoclonal antibody targeting MSH6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 66172-1-Ig targets MSH6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, U2OS cells, A431 cells, HeLa cells, MCF-7 cells, K-562 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human tonsillitis tissue, Ramos cellsNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12645 Product name: Recombinant human MSH6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-400 aa of BC004246 Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE Predict reactive species Full Name: mutS homolog 6 (E. coli) Calculated Molecular Weight: 153 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: BC004246 Gene Symbol: MSH6 Gene ID (NCBI): 2956 RRID: AB_2881567 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52701 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924