Proteintech, 66172-2-Ig, MSH6 Monoclonal antibody

Size: 20ul / 150ul The MSH6 (66172-2-Ig) by Proteintech is a Monoclonal antibody targeting MSH6 in IHC, ELISA applications with reactivity to human samples 66172-2-Ig targets MSH6 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human colon tissue, human colon cancer tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12645 Product name: Recombinant human MSH6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-400 aa of BC004246 Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE Predict reactive species Full Name: mutS homolog 6 (E. coli) Calculated Molecular Weight: 153 kDa Observed Molecular Weight: 150-160 kDa GenBank Accession Number: BC004246 Gene Symbol: MSH6 Gene ID (NCBI): 2956 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P52701 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.