Iright
BRAND / VENDOR: Proteintech

Proteintech, 66186-1-Ig, Fibrinogen Beta Chain Monoclonal antibody

CATALOG NUMBER: 66186-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Fibrinogen Beta Chain (66186-1-Ig) by Proteintech is a Monoclonal antibody targeting Fibrinogen Beta Chain in WB, ELISA applications with reactivity to human samples 66186-1-Ig targets Fibrinogen Beta Chain in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Fibrinogen is a soluble plasma glycoprotein synthesized in the liver. It is composed of two sets of three structurally different subunits: alpha (FGA), beta (FGB), gamma (FGG). Fibrinogen is converted by thrombin into fibrin during blood coagulation. Fibrinogen and fibrin play overlapping roles in blood clotting, fibrinolysis, cellular and matrix interactions, the inflammatory response, wound healing, and neoplasia (PMID: 16102057). FGB is the beta chain of fibrinogen. During conversion of fibrinogen to fibrin, fibrinopeptide B is cleaved from FGB by thrombin. Mutations in the gene of FGB lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10205 Product name: Recombinant human FGB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 142-491 aa of BC107766 Sequence: SSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEITRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ Predict reactive species Full Name: fibrinogen beta chain Calculated Molecular Weight: 491 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC107766 Gene Symbol: Fibrinogen Beta Chain Gene ID (NCBI): 2244 RRID: AB_2881581 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02675 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924