Iright
BRAND / VENDOR: Proteintech

Proteintech, 66188-1-Ig, Septin 8 Monoclonal antibody

CATALOG NUMBER: 66188-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Septin 8 (66188-1-Ig) by Proteintech is a Monoclonal antibody targeting Septin 8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66188-1-Ig targets Septin 8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Septin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are membrane-associated GTPases which are involved in cytokinesis and cellular morphogenesis. Septin 8 is an interaction partner of Septin 4. It may play a role in platelet secretion. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19114 Product name: Recombinant human SEPT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC001329 Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK Predict reactive species Full Name: septin 8 Calculated Molecular Weight: 55.6 kDa Observed Molecular Weight: 50-58 kDa GenBank Accession Number: BC001329 Gene Symbol: Septin 8 Gene ID (NCBI): 23176 RRID: AB_2881583 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: Q92599 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924