Proteintech, 66195-1-Ig, MTA2 Monoclonal antibody

Size: 20ul / 150ul The MTA2 (66195-1-Ig) by Proteintech is a Monoclonal antibody targeting MTA2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66195-1-Ig targets MTA2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SW480 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: mouse brain tissue, human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 ug per 10^6 cells in a 100 µl suspension Background Information Metastasis-associated protein MTA2, also named as MTA1L1 or PID, is a 668 amino acid protein, which contains one BAH domain, one ELM2 domain, one GATA-type zinc finger and one SANT domain. MTA2 localizes in the nucleus and is widely expressed in many tissues. MTA2 may be involved in the regulation of gene expression as repressor and activator. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11713 Product name: Recombinant human MTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC053650 Sequence: MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV Predict reactive species Full Name: metastasis associated 1 family, member 2 Calculated Molecular Weight: 668 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC053650 Gene Symbol: MTA2 Gene ID (NCBI): 9219 RRID: AB_2877118 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O94776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.