Iright
BRAND / VENDOR: Proteintech

Proteintech, 66204-1-Ig, MCM2 Monoclonal antibody

CATALOG NUMBER: 66204-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MCM2 (66204-1-Ig) by Proteintech is a Monoclonal antibody targeting MCM2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66204-1-Ig targets MCM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells, A431 cells, 4T1 cells, A549 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: Human tonsillitis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0798 Product name: Recombinant human MCM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 657-904 aa of BC007670 Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF Predict reactive species Full Name: minichromosome maintenance complex component 2 Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 116-125 kDa GenBank Accession Number: BC007670 Gene Symbol: MCM2 Gene ID (NCBI): 4171 RRID: AB_2881595 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924