Proteintech, 66205-1-Ig, Myoglobin Monoclonal antibody

Size: 20ul / 150ul The Myoglobin (66205-1-Ig) by Proteintech is a Monoclonal antibody targeting Myoglobin in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66205-1-Ig targets Myoglobin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, pig heart tissue, rat heart tissue, mouse heart tissue, rabbit heart tissue, human heart tissue Positive IHC detected in: human heart tissue, mouse tongue tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells Positive FC (Intra) detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:80000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Myoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8979 Product name: Recombinant human MB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species Full Name: myoglobin Calculated Molecular Weight: 154 aa, 17 kDa Observed Molecular Weight: 17-18 kDa GenBank Accession Number: BC014547 Gene Symbol: Myoglobin Gene ID (NCBI): 4151 RRID: AB_2881596 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02144 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.