Proteintech, 66209-1-Ig, ST6GALNAC6 Monoclonal antibody

Size: 20ul / 150ul The ST6GALNAC6 (66209-1-Ig) by Proteintech is a Monoclonal antibody targeting ST6GALNAC6 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66209-1-Ig targets ST6GALNAC6 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IHC detected in: mouse colon tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ST6GALNAC6 is a sialyltransferase which is responsible for the synthesis of all a-series gangliosides. It has a broad expression pattern. ST6GALNAC6 was reported to be a key enzyme in the synthesis of disialyl monosialyl Lewis (Lea), a representative tumor-associated antigen in cancers of the pancreas and colon. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8358 Product name: Recombinant human ST6GALNAC6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 67-333 aa of BC007802 Sequence: VFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT Predict reactive species Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 Calculated Molecular Weight: 333aa,38 kDa; 374aa,41 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC007802 Gene Symbol: ST6GALNAC6 Gene ID (NCBI): 30815 RRID: AB_2881600 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q969X2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.