Product Description
Size: 20ul / 150ul
The CNN2 (66244-1-Ig) by Proteintech is a Monoclonal antibody targeting CNN2 in WB, IHC, ELISA applications with reactivity to human, pig samples
66244-1-Ig targets CNN2 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.
Tested Applications
Positive WB detected in: HepG2 cells, A431 cells, HeLa cells, pig stomach tissue, HT-1080 cells, Jurkat cells, K-562 cells
Positive IHC detected in: human breast hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:4000
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.
Specification
Tested Reactivity: human, pig
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag23594 Product name: Recombinant human CNN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species
Full Name: calponin 2
Calculated Molecular Weight: 309 aa, 34 kDa
Observed Molecular Weight: 34-36 kDa
GenBank Accession Number: BC141818
Gene Symbol: CNN2
Gene ID (NCBI): 1265
RRID: AB_2881633
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q99439
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924