Iright
BRAND / VENDOR: Proteintech

Proteintech, 66247-1-Ig, IMP3 Monoclonal antibody

CATALOG NUMBER: 66247-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IMP3 (66247-1-Ig) by Proteintech is a Monoclonal antibody targeting IMP3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 66247-1-Ig targets IMP3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, SKOV-3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information IMP3 is a member of the insulin-like growth factor (IGF-II) mRNA binding protein (IMP) family that consist of IMP1, IMP2, and IMP3. IMP3 is an oncofetal protein associated with aggressive and advanced tumors and is specifically expressed in malignant tumors but not found in benign tissues [PMID:22497850]. IMP3 forms a ternary complex with IMP4 and MPP10 (MPHOSPH10) that interacts with U3 small nucleolar RNA (snoRNA), which is required for the early cleavage steps in pre-rRNA processing[PMID: 12655004]. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23602 Product name: Recombinant human IMP3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-184 aa of BC020557 Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA Predict reactive species Full Name: IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) Calculated Molecular Weight: 184 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC020557 Gene Symbol: IMP3 Gene ID (NCBI): 55272 RRID: AB_2881636 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NV31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924