Iright
BRAND / VENDOR: Proteintech

Proteintech, 66262-1-Ig, AIRE Monoclonal antibody

CATALOG NUMBER: 66262-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AIRE (66262-1-Ig) by Proteintech is a Monoclonal antibody targeting AIRE in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 66262-1-Ig targets AIRE in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human spleen tissue, pig spleen tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19103 Product name: Recombinant human AIRE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-348 aa of BC137270 Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS Predict reactive species Full Name: autoimmune regulator Calculated Molecular Weight: 545 aa, 58 kDa Observed Molecular Weight: 58-69 kDa GenBank Accession Number: BC137270 Gene Symbol: AIRE Gene ID (NCBI): 326 RRID: AB_2881649 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924