Proteintech, 66266-1-Ig, SRPX2 Monoclonal antibody

Size: 20ul / 150ul The SRPX2 (66266-1-Ig) by Proteintech is a Monoclonal antibody targeting SRPX2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig, mouse samples 66266-1-Ig targets SRPX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig, mouse samples. Tested Applications Positive WB detected in: pig lung tissue, A549 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SRPX2 (sushi-repeat-containing protein, X-linked 2) is a secreted protein expressed in neurons of the human adult brain, including the rolandic area (PMID: 20874700). Firstly described as sushi-repeat protein up-regulated in leukemia (SPRUL) in leukemia cells with dysregulated expression at the transcriptional level, SRPX2 has been recently shown as a multifunctional protein. SRPX2 is a ligand for uPAR, the urokinase-type plasminogen activator (uPA) receptor (PMID: 18718938). It is involved in seizure disorders, angiogenesis and cellular adhesion (PMID: 22242148; 19667118; 16497722). The involvement of SRPX2 in disorders of language cortex suggests it has an important role in the perisylvian region critical for language and cognitive development (PMID: 16497722). Specification Tested Reactivity: human, pig, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8084 Product name: Recombinant human SRPX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 166-465 aa of BC020733 Sequence: DGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGASCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE Predict reactive species Full Name: sushi-repeat-containing protein, X-linked 2 Calculated Molecular Weight: 465 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC020733 Gene Symbol: SRPX2 Gene ID (NCBI): 27286 RRID: AB_2721268 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.