Proteintech, 66275-1-Ig, ERCC1 Monoclonal antibody

Size: 20ul / 150ul The ERCC1 (66275-1-Ig) by Proteintech is a Monoclonal antibody targeting ERCC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 66275-1-Ig targets ERCC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Excision Repair Cross Complementing 1 (ERCC1) is a structure-specific endonuclease that is responsible for the 5'-incision during DNA repair. It forms a complex with ERCC11, XPF and ERCC4, which are required in both recombinatorial repair and nucleotide excision repair. It has been found that ERCC1, together with RRM1, are determinants of survival after surgical treatment of early-stage, non-small-cell lung cancer. (Ref: Simon, ER. 2005) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6417 Product name: Recombinant human ERCC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-323 aa of BC052813 Sequence: MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC052813 Gene Symbol: ERCC1 Gene ID (NCBI): 2067 RRID: AB_2881658 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07992 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.