Proteintech, 66309-1-Ig, PEX5 Monoclonal antibody

Size: 20ul / 150ul The PEX5 (66309-1-Ig) by Proteintech is a Monoclonal antibody targeting PEX5 in WB, IHC, ELISA applications with reactivity to human, pig, rat samples 66309-1-Ig targets PEX5 in WB, IHC, ELISA applications and shows reactivity with human, pig, rat samples. Tested Applications Positive WB detected in: pig brain tissue, HEK-293 cells, fetal human brain tissue Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder. Specification Tested Reactivity: human, pig, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3268 Product name: Recombinant human PEX5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 340-639 aa of BC010621 Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ Predict reactive species Full Name: peroxisomal biogenesis factor 5 Calculated Molecular Weight: 631 aa, 70 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC010621 Gene Symbol: PEX5 Gene ID (NCBI): 5830 RRID: AB_2881691 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.