Product Description
Size: 20ul / 150ul
The JUN (66313-1-Ig) by Proteintech is a Monoclonal antibody targeting JUN in WB, ELISA applications with reactivity to human, mouse, rat samples
66313-1-Ig targets JUN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: MDA-MB-231 cells, ROS1728 cells, Saos-2 cells, HEK-293 cells, NIH/3T3 cells, RKO cells
Positive FC (Intra) detected in: NIH/3T3 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
What is the molecular weight of JUN?The molecular weight of JUN is approximately 39 kDa.What is the cellular localization of JUN?JUN expression can be located in the nucleus. However, ubiquitinated JUN colocalizes with lysosomal proteins (PMID: 15469925).What is the function of JUN?JUN is a basic leucine zipper (bZIP) transcription factor that recognizes and binds to a consensus heptamer motif of 5'-TGA[CG]TCA-3' in the enhancer region of target genes. JUN acts as either a homo- or heterodimer and binds to the DNA to regulate transcriptional activity, specifically promoting the activity of NR5A1 when phosphorylated by HIPK3, leading to increased steroidogenic gene expression upon the stimulation of the cAMP signaling pathway (PMID: 9732876).What post-translational modifications is JUN subjected to?JUN is acetylated at Lys-271 by EP300 (PMID: 11689449). JUN is phosphorylated by PLK3 following exposure to hypoxia or UV irradiation, which leads to increased DNA-binding activity (PMID: 27281822), and also by PAK2 at numerous threonine residues to promote cell proliferation and transformation (PMID: 21177766). JUN is also phosphorylated by DYRK2 at Ser-243, which primes it for subsequent further phosphorylation by GSK3B and reduces its ability to bind DNA (PMID: 22307329).What is the role of JUN in disease?Activation of JUN is linked with proliferation and angiogenesis in invasive breast cancers (PMID: 16733206).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag17639 Product name: Recombinant human JUN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-227 aa of BC068522 Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE Predict reactive species
Full Name: jun oncogene
Calculated Molecular Weight: 331 aa, 36 kDa
Observed Molecular Weight: 39 kDa
GenBank Accession Number: BC068522
Gene Symbol: JUN
Gene ID (NCBI): 3725
RRID: AB_2881694
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P05412
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924