Proteintech, 66319-1-Ig, IL-21R Monoclonal antibody

Size: 20ul / 150ul The IL-21R (66319-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-21R in WB, IHC, ELISA applications with reactivity to human samples 66319-1-Ig targets IL-21R in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, A172 cells, MJ cells, K-562 cells, TF-1 cells, MOLT-4 cells, HuT 78 cells, NK-92 cells, human placenta tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Background Information IL21R, a receptor for interleukin-21, belongs to the type I cytokine receptor family. IL21R has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21295 Product name: Recombinant human IL-21R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 239-538 aa of BC004348 Sequence: LLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS Predict reactive species Full Name: interleukin 21 receptor Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC004348 Gene Symbol: IL-21R Gene ID (NCBI): 50615 RRID: AB_2881700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HBE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.