Iright
BRAND / VENDOR: Proteintech

Proteintech, 66326-1-Ig, 5 Lipoxygenase Monoclonal antibody

CATALOG NUMBER: 66326-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The 5 Lipoxygenase (66326-1-Ig) by Proteintech is a Monoclonal antibody targeting 5 Lipoxygenase in WB, IHC, ELISA applications with reactivity to human, pig samples 66326-1-Ig targets 5 Lipoxygenase in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig spleen tissue, THP-1 cells Positive IHC detected in: human lung tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information ALOX5(arachidonate 5-lipoxygenase) is also named as LOG5, 5-LO and belongs to the lipoxygenase family. It catalyzes the first step in leukotriene biosynthesis, and plays a role in inflammatory processes. It is a 78 kDa iron-containing enzyme that translocates from the cytosol to associate with FLAP, and converts arachidonate in two steps into the unstable intermediate LTA4. It is essential for cysteinyl-leukotriene (cys-LT) production, critical mediators in asthma(PMID:12911785). Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18168 Product name: Recombinant human ALOX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC130332 Sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWL Predict reactive species Full Name: arachidonate 5-lipoxygenase Calculated Molecular Weight: 674 aa, 78 kDa Observed Molecular Weight: 70-78 kDa GenBank Accession Number: BC130332 Gene Symbol: 5 Lipoxygenase Gene ID (NCBI): 240 RRID: AB_2881707 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09917 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924