Proteintech, 66348-1-Ig, Dermatopontin Monoclonal antibody

Size: 20ul / 150ul The Dermatopontin (66348-1-Ig) by Proteintech is a Monoclonal antibody targeting Dermatopontin in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 66348-1-Ig targets Dermatopontin in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat skin tissue, human testis tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the inhibition activity of TGF-beta1. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6200 Product name: Recombinant human DPT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC033736 Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV Predict reactive species Full Name: dermatopontin Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC033736 Gene Symbol: DPT/TRAMP Gene ID (NCBI): 1805 RRID: AB_2881728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q07507 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.