Proteintech, 66351-1-Ig, COX2/ Cyclooxygenase 2/ PTGS2 Monoclonal antibody

Size: 20ul / 150ul The COX2/ Cyclooxygenase 2/ PTGS2 (66351-1-Ig) by Proteintech is a Monoclonal antibody targeting COX2/ Cyclooxygenase 2/ PTGS2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66351-1-Ig targets COX2/ Cyclooxygenase 2/ PTGS2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, LPS treated HeLa cells, LPS treated RAW 264.7 cells Positive IHC detected in: human cervical cancer tissue, human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information COX2 is an enzyme involved in the synthesis of prostaglandins from arachidonic acid.1.What is the molecular weight of COX2?The fully N-glycosylated PTGS2 is 72-74 kDa and the aglycosylated is 66 kDa (PMID:19656660). It alsoexpresses a band of 39 kDa after unspecific cleavage (PMID:17509125). The 50 kDa band of fragmentedPTGS2 has also previously been detected in AD brains (PMID:14724276).2.Is COX2 post-translationally modified?COX2 is a subject of post-translational modifications, including phosphorylation, glycosylation, ands-nitrosylation (PMID: 28939645).3.What is the difference between COX1, COX2, and COX3?There are three isoenzymes that have cyclooxygenase activity: COX1, COX2, and COX3. While COX1is a ubiquitously expressed constitutive enzyme, expression of COX2 is generally low but can be rapidlyinduced by various stimuli (as part of infection and inflammatory response) and is controlled by thetranscription factor NFκB. COX3 is an alternative splice variant of COX1 enzyme and is considerednon-functional in humans.4.I cannot detect COX2 in my sample during western blotting.Unlike COX1, COX2 expression is inducible by a variety of stimuli including certain growth factors,cytokines,and proinflammatory stimuli. COX2 basal expression levels may be very low in unstimulatedcells. Additionally,the COX2 half-life time is short and after stimulation, COX2 protein can be quicklydegraded to basal levels(PMID: 10966456), which should be taken into account during experimental design.5.What is the role of COX2 in cancer?COX2 is often upregulated in various cancer types and increased expression of COX2 is associatedwithgreater angiogenesis of solid tumors, increased invasion, and metastasis, as well as decreasedhost immunity.6.What is subcellular localization of COX2?Both COX1 and COX2 are present in the endoplasmic reticulum (ER) and nuclear envelope(PMID: 9545330),but COX2 has been reported to be more enriched in the nuclear envelopecompared to COX1 (PMID: 7738031). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24721 Product name: Recombinant human COX2/ Cyclooxygenase 2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 20-366 aa of BC013734 Sequence: PCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAE Predict reactive species Full Name: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) Calculated Molecular Weight: 604 aa, 68 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC013734 Gene Symbol: COX2/PTGS2 Gene ID (NCBI): 5743 RRID: AB_2881731 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35354 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.