Proteintech, 66370-1-Ig, BMP-5 Monoclonal antibody

Size: 20ul / 150ul The BMP-5 (66370-1-Ig) by Proteintech is a Monoclonal antibody targeting BMP-5 in WB, ELISA applications with reactivity to human, pig samples 66370-1-Ig targets BMP-5 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig lung tissue, pig liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Bone morphogenetic protein-5 (BMP5), is a member of the TGF-beta superfamily. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. BMP5 may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. BMP5 is differentially regulated in multiple human cancers. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3952 Product name: Recombinant human BMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-348 aa of BC027958 Sequence: GLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSE Predict reactive species Full Name: bone morphogenetic protein 5 Calculated Molecular Weight: 454 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC027958 Gene Symbol: BMP5 Gene ID (NCBI): 653 RRID: AB_2881749 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P22003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.