Iright
BRAND / VENDOR: Proteintech

Proteintech, 66386-1-Ig, PADI2 Monoclonal antibody

CATALOG NUMBER: 66386-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PADI2 (66386-1-Ig) by Proteintech is a Monoclonal antibody targeting PADI2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, rabbit, pig samples 66386-1-Ig targets PADI2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, HeLa cells, MCF-7 cells, pig brain tissue, rat brain tissue, mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PADI2, also named as KIAA0994, PDI2, PAD-H19 and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa. Specification Tested Reactivity: human, mouse, rat, rabbit, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17612 Product name: Recombinant human PADI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-438 aa of BC009701 Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL Predict reactive species Full Name: peptidyl arginine deiminase, type II Calculated Molecular Weight: 665 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC009701 Gene Symbol: PADI2 Gene ID (NCBI): 11240 RRID: AB_2881762 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y2J8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924