Proteintech, 66390-1-Ig, CD74 Monoclonal antibody

Size: 20ul / 150ul The CD74 (66390-1-Ig) by Proteintech is a Monoclonal antibody targeting CD74 in WB, IF/ICC, ELISA applications with reactivity to human samples 66390-1-Ig targets CD74 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells, Daudi cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species Full Name: CD74 molecule, major histocompatibility complex, class II invariant chain Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC018726 Gene Symbol: CD74 Gene ID (NCBI): 972 RRID: AB_2881766 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04233 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.