Proteintech, 66394-1-Ig, Calbindin-D28k Monoclonal antibody

Size: 20ul / 150ul The Calbindin-D28k (66394-1-Ig) by Proteintech is a Monoclonal antibody targeting Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66394-1-Ig targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rabbit brain tissue, PC-12 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IHC detected in: rat cerebellum tissue, human kidney tissue, human small intestine tissue, human brain tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue, human kidney tissue, rat cerebellum tissue Positive IF-Fro detected in: mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:8000-1:32000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:400-1:1600 Background Information Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species Full Name: calbindin 1, 28kDa Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC006478 Gene Symbol: Calbindin Gene ID (NCBI): 793 RRID: AB_2881769 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05937 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.